Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела кроличьи поликлональные Anti-ALDH3B1, 100 мкг, Abcam

Антитела кроличьи поликлональные Anti-ALDH3B1, 100 мкг, Abcam


Антитела кроличьи поликлональные Anti-ALDH3B1, 100 мкг
Наименование товара: Anti-ALDH3B1 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к ALDH3B1
Тип хозяина: кролик
Протестированные области применения: вестерн-блотинг (WB); иммуноцитохимия (ICC / IF)
Кросс-реактивность: мышь, крыса, человек
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий человеческому ALDH3B1.
Последовательность:
GGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGK
NPC
YVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPAL
QST
ITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSDESDR
YIA
PTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREKPLAL
YAF
SNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYH
GKF SFDTFSHHRACLLRSPGMEKLNALRYPPQSPR
Положительный контроль: WB: лизат цельных клеток K562; лизаты ткани почек и селезенки крыс; лизат тканей желудка мыши;
ICC / IF: клетки A549
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (1-2 недели). После доставки аликвотировать. Хранить при температуре -20 ° C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,40;
  • консервант (проклин) - 0,03%;
  • глицерин - 50%;
  • натрий-фосфатный буфер
Концентрация: пр фасовке 100 мкл, концентрация 3 мг/мл
Метод очистки: очищено с помощью протеина G
Чистота: чистота > 95%
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: передача сигнала — метаболизм — алкогольный обмен;
клеточная биология — другие антитела — окислительный стресс;
метаболизм — пути и процессы — метаболические сигнальные пути — алкогольный обмен