Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-DNA Ligase III antibody, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-DNA Ligase III antibody, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-DNA Ligase III antibody, 100 мкл
Наименование товара: Anti-DNA Ligase III/LIG3 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к DNA Лигаза III/LIG3
Тип хозяина: кролик
Протестированные области применения: IHC-P, WB, ICC/IF
Кросс-реактивность: мышь, крыса, человек
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий человеческой ДНК-лигазе III / LIG3 aa 254-390.
Последовательность:
CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDV
YLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDV
SET IRVFFEQSKSFPPAAKSLLTIQLTEFLLSK
Положительный контроль: IHC: ткань семенников человека;
WB: A549, NIH-3T3 и лизат цельных клеток линии крыс NBT-II;
ICC / IF: клетки U-251 MG
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (1-2 недели). После доставки аликвотировать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,20;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер;
  • глицерин - 40%
Концентрация: при фасовке 100 мкл, концентрация 0,1 мг/мл
Метод очистки: средство очищено
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: эпигенетика и ядерная сигнализация — ДНК / РНК — синтез ДНК — ДНК-лигазы