Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-EAAT2 antibody, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-EAAT2 antibody, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-EAAT2 antibody, 100 мкл
Наименование товара: Anti-EAAT2 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к EAAT2
Тип хозяина: кролик
Протестированные области применения: WB (вестерн-блоттинг), IHC-P (иммуногистохимия c фиксированием в формалине / PFA с фиксированием в парафине)
Кросс-реактивность: мышь, крыса, человек
Иммуноген (антиген): синтетический пептид, соответствующий человеческому EAAT2 aa 143-190, конъюгированный с гемоцианин лимфы улитки (KLH).
Последовательность:
HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQT
Положительный контроль: ткань головного мозга крысы
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (1-2 недели). После доставки аликвотировать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • консервант (азид натрия) - 0,09%;
  • глицерин - 50%;
  • БСа - 0,01%
Водный буферный раствор
Концентрация: при фасовке 100 мкл, концентрация 1 мг/мл
Метод очистки: очищено с помощью протеина А
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: неврология — нейротрансмиттер — аминокислоты — глютамат