Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-PARP3 antibody, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-PARP3 antibody, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-PARP3 antibody, 100 мкл
Наименование товара: Anti-PARP3/IRT1 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к PARP3/IRT1
Тип хозяина: кролик
Протестированные области применения: WB (вестерн-блоттинг)
Кросс-реактивность: мышь, крыса, человек
Иммуноген (антиген): синтетический пептид, соответствующий человеческому PARP3 / IRT1 aa 11-56.
Последовательность:
TEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSS
Положительный контроль: лизаты цельных клеток HEK293T, Raw264.7 и H9C2
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при +4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре -20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,30;
  • консервант (азид натрия) - 0,05%;
  • натрий-фосфатный буфер - 99%
Концентрация: при фасовке 100 мкл, концентрация 1 мг/мл
Метод очистки: очищено иммуногенно. Антитела очищали аффинно от кроличьей антисыворотки с использованием эпитоп-специфического иммуногена, чистота > 95% (по данным SDS-PAGE)
Клональность: поликлональные антитела
Изотип: IgG
Области применения: клеточная биология — апоптоз — ядро — PARP;
эпигенетика и ядерная сигнализация — Chromatin Modifying Enzymes — АДФ-рибозилирование;
эпигенетика и ядерная сигнализация — ДНК / РНК — Повреждение и восстановление ДНК — ответ на повреждение ДНК — повреждение ДНК;
рак — клеточная гибель — апоптоз — ядро — PARP