Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-Interferon alpha 1, 100 мкг, Abcam

Антитела поликлональные кроличьи Anti-Interferon alpha 1, 100 мкг, Abcam


Антитела поликлональные кроличьи Anti-Interferon alpha 1, 100 мкг
Наименование товара: Anti-Interferon alpha 1 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к интерферону альфа 1
Тип хозяина: кролик
Протестированные области применения: WB (вестерн-блоттинг)
Кросс-реактивность: мышь, крыса, человек
Иммуноген (антиген): синтетический пептид, соответствующий человеческому интерферону альфа 1 аа 63-108.
Последовательность:
QEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKF
Положительный контроль: WB: лизаты цельных клеток HEK-293T, NIH / 3T3 и H9c2
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,20;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер;
  • глицерин - 50%
Концентрация: при фасовке 100 мкг, концентрация 1 мг/мл
Метод очистки: очищено иммуногенно ab191903. Очищали от кроличьей антисыворотки с помощью аффинной хроматографии с использованием эпитоп-специфического иммуногена, и чистота составляет > 95% (по данным SDS-PAGE)
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: иммунология — врожденный иммунитет — цитокины — интерфероны;
рак — опухолевая иммунология — цитокины — интерфероны