Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-HEXA antibody - C-terminal, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-HEXA antibody - C-terminal, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-HEXA antibody - C-terminal, 100 мкл
Наименование товара: Anti-HEXA antibody - C-terminal Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к HEXA - C-конец
Тип хозяина: кролик
Протестированные области применения: WB (вестерн-блоттинг)
Кросс-реактивность: мышь, крыса, человек;
также может реагировать с: коровой, орангутаном
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий HEXA человека aa 270-529 (C-terminal).
Последовательность:
IPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFY
LHL
GGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSY
GKG
YVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALL
SAP
WYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDN
TNL
VPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQP
LNV GFCEQEFEQT
Положительный контроль: WB: клеточные лизаты MCF7, BT474, SW620, HepG2 и HT29; лизаты яичка и ткани мозга
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (1-2- недели). После доставки аликвотрировать и хранить при -20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,30;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер - 49%;
  • глицерин - 50%
Концентрация: при фасовке 100 мкл, концентрация 3,03 мг/мл
Метод очистки: очищено иммуногенно
Клональность: поликлональные антитела
Изотип: IgG
Области применения: метки и клеточные маркеры — субклеточные маркеры — органеллы — лизосома;
неврология — неврологический процесс — нейродегенеративное заболевание — другое;
неврология — неврологический процесс — нейрогенез