Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Моноклональные антитела Anti-SCP3 antibody [6F9C5] (ab181746), Abcam

Моноклональные антитела Anti-SCP3 antibody [6F9C5] (ab181746), Abcam


Моноклональные антитела Anti-SCP3 antibody [6F9C5] (ab181746)
Наименование товара: Anti-SCP3 antibody [6F9C5] Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела мышиные моноклональные [6F9C5] к SCP3
Тип хозяина: мышь
Протестированные области применения: IHC-P, WB, ICC/IF, Flow Cyt
Кросс-реактивность: человек;
также может реагировать с макакой-крабоедом
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий человеческому SCP3 аа 27-128. Эквивалентно кишечной палочке.
Последовательность:
FETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNM
LEG
VGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQ
EYS QQ
Положительный контроль: рекомбинантный белок SCP3; клеточный лизат HEK293, трансфицированный SCP3 (aa 27-128) -hIgGFc; клетки HepG2; клетки Jurkat; рак шейки матки человека и ткани почек человека
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре - 20°C стабильно в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • консервант (азид натрия) - 0,05%;
  • натрий-фосфатный буфер - 99%;
  • белковый стабилизатор - 0,5%
Концентрация: при фасовке 100 мкл, концентрация 1 мг/мл
Метод очистки: очищено с помощью протеина G. Очищено от супернатанта культуры ткани
Клональность: моноклональные антитела
Клон: 6F9C5
Изотип: IgG1
Области исследования: клеточная биология — клеточный цикл — деление клеток — хроматидная сплоченность;
эпигенетика и ядерная сигнализация — клеточный цикл — структура хромосом — хроматидная сплоченность