Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-Protein G antibody, 100 мкг, Abcam

Антитела поликлональные кроличьи Anti-Protein G antibody, 100 мкг, Abcam


Антитела поликлональные кроличьи Anti-Protein G antibody, 100 мкг
Наименование товара: Anti-Protein G antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к протеину G
Тип хозяина: кролик
Протестированные области применения: IHC-P (иммуногистохимия c фиксированием в формалине / PFA с фиксированием в парафине), WB (вестерн-блоттинг)
Иммуноген (антиген): полноразмерный нативный белок (очищенный), соответствующий протеину G aa 34-562. Различные виды стрептококков.
Последовательность:
VDSPIEDTPIIRNGGELTNLLGNSETTLALRNEESATADLTAAAVAD
TVA
AAAAENAGAAAWEAAAAADALAKAKADALKEFNKYGVSDYYKNLINN
AKT
VEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELA
EAK
VLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISE
ATD
GLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINN
AKT
VEGVKALIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKV
FKQ
YANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVING
KTL
KGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPE
VID
ASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGV
DGV
WTYDDATKTFTVTEMVTEVPGDAPTEPEKPEASIPLVPLTPATPIAK
DDA KKDDTKKEDAKKPEAKKEDAKKAETLPTT
Положительный контроль: кроличья сыворотка, очищенный и частично очищенный белок G
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (1-2 недели). После доставки аликвотровать. Хранить при температуре - 20°C в течение длительного времение. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,20;
  • консервант (азид натрия) - 0,01%;
  • хлорид натрия - 0,88%;
  • фосфат калия - 0,27%
Концентрация: при фасовке 100 мкг, концентрация 1 мг/мл
Метод очистки: фракция IgG
Примечания о методе очистки: ab181700 представляет собой антитело фракции IgG, очищенное от моноспецифической антисыворотки многостадийным процессом, который включает делипидирование, фракционирование соли и ионообменную хроматографию с последующим обширным диализом против буфера, в котором он содержится
Клональность: поликлональные антитела
Изотип: IgG
Области применения: метки и клеточные маркеры — маркер гибридного белка — протеин G