Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи, Anti-Ovalbumin, 100 мкг, Abcam

Антитела поликлональные кроличьи, Anti-Ovalbumin, 100 мкг, Abcam


Антитела поликлональные кроличьи, Anti-Ovalbumin, 100 мкг
Наименование товара: Anti-Ovalbumin antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к овальбумину
Тип хозяина: кролик
Протестированные области применения: IP (иммунопреципитация), IHC-P (иммуногистохимия c фиксированием в формалине / PFA с фиксированием в парафине), WB (вестерн-блоттинг), ELISA (ИФА)
Кросс-реактивность: курица
Иммуноген (антиген): полноразмерный нативный белок (очищенный), соответствующий куриному овальбумину аа 2-386. (Очищенно от куриного яичного белка).
Последовательность:
GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKD
STR
TQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVY
SFS
LASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELIN
SWVE
SQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMP
FRV
TEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPD
EVS
GLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVL
MAM
GITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEA
GVD AASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP
Положительный контроль: белок овальбумин
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре -20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,20;
  • консервант (азид натрия) - 0,01%;
  • фосфат калия - 0,27%;
  • хлорид натрия - 0,88%
Концентрация: при фасовке 100 мкг, концентрация 1 мг/мл
Метод очистки: очищено с помощью фракции IgG. Антитело очищенное от моноспецифической антисыворотки многостадийным процессом, который включает делипидирование, фракционирование соли и ионообменную хроматографию с последующим диализом
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: клеточная биология — протеолиз / убиквитин — ингибиторы протеазы — ингибиторы сериновой протеазы — серпины