Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti- Junctional Adhesion Molecule, 100 мкг, Abcam

Антитела поликлональные кроличьи Anti- Junctional Adhesion Molecule, 100 мкг, Abcam


Антитела поликлональные кроличьи Anti- Junctional Adhesion Molecule, 100 мкг
Наименование товара: Anti-Junctional Adhesion Molecule 1/JAM-A antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к Junctional Adhesion Molecule 1/JAM-A
Тип хозяина: кролик
Протестированные области применения: WB, IHC-P, ICC/IF
Кросс-реактивность: человек, мышь, крыса
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий Молекуле клеточной адгезии JAM-A aa 30-238. Внеклеточный домен.
Последовательность:
TVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYN
NKI
TASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKL
IVL
VPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTN
PKS
TRAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNA
VRM EAVERNVGV

Ссылка на базу данных: Q9Y624
Положительный контроль: рекомбинантный белок Junction-Adlesion Molelele 1 / JAM-A в WB. Клеточный лизат HeLa
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать и хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,30;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер - 49%;
  • глицерин - 50%
Концентрация: при фасовке 100 мкл, диапазон концентрации 1,52 - 4,28 мг/мл
Метод очистки: очищено иммуногенно
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: сердечно-сосудистая система — кровь — тромбоциты;
передача сигнала — цитоскелет / ECM — клеточная адгезия — узкие соединения;
сердечно-сосудистая система — атеросклероз — воспаление сосудов — рекрутинг лейкоцитов — молекулы клеточного соединения