Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-TIMP2 antibody, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-TIMP2 antibody, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-TIMP2 antibody, 100 мкл
Наименование товара: Anti-TIMP2 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к TIMP2
Тип хозяина: кролик
Протестированные области применения: IHC-P (иммуногистохимия c фиксированием в формалине / PFA с фиксированием в парафине), WB (вестерн-блоттинг), ICC-IF (иммуноцитохимия / иммунофлуоресценция)
Кросс-реактивность: мышь, крыса, человек;
также может реагировать с: кроликом, морской свинкой, коровой, собакой, китайским хомяком
Иммуноген (антиген): рекомбинантный белок полной длины, соответствующий человеческому TIMP2 aa 27-220. Зрелый белок.
Последовательность:
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEI
KQI
KMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMH
ITL
CDFIVPWDTLSTTQKKSKKKKHKKHKKHKKKHKKKHKKKKKKKKKHK
KKHKKKKKKKKKKKKKKKKKKKKKKK!
Положительный контроль: экстракт клеточной линии SW480
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,30;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер - 49%;
  • глицерин - 50%
Концентрация: при фасовке 100 мкл, диапазон концентрации 1,3 - 2 мг/мл
Метод очистки: очищено с помощью протеина А
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: сердечно-сосудистая система — развитие кровеносных сосудов — Адгезия / ECM — матричные металлопротеиназы — TIMP;
передача сигнала — цитоскелет / ECM — внеклеточный матрикс — ECM ферменты — ММП ингибиторы;
рак — вторжение / микросреда — развитие кровеносных сосудов — ECM ферменты — TIMPs;
рак — вторжение / микросреда — ECM — внеклеточный матрикс — TIMPs;
клеточная биология — протеолиз / убиквитин — ингибиторы протеазы — ингибиторы металлопротеаз — TIMPs;
сердечно-сосудистая система — атеросклероз — тромбоз — эндотелиальные медиаторы / регуляторы