Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела Anti-BMPR1B antibody, Abcam

Антитела Anti-BMPR1B antibody, Abcam


Антитела Anti-BMPR1B antibody
Наименование товара: Anti-BMPR1B antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к BMPR1B
Тип хозяина: кролик
Протестированные области применения: ICC/IF, IHC-P, WB
Кросс-реактивность: мышь, крыса, человек, курица
Иммуноген (антиген): рекомбинантный полноразмерный белок, соответствующий человеческому BMPR1B aa 1-502.
Последовательность:
MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNIC
STD
GYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCT
ERN
ECNKDLHPTLPPLKNRDFVDGPIHHRALLISVTVCSLLLVLIILFCY
FRY
KRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQ
RTI
AKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEI
YQT
VLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLD
AKS
MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCC
IAD
LGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIM
ADM
YSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIK
KLR
PSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSES
QDI KL
Положительный контроль: WB: лизат клеток U-251MG и лизат почечной ткани мыши;
IHC: раковая ткань желудка человека и миндалины человека. Яичники крысы и печень мыши;
ICC / IF: клетки L929
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,30;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер - 49%;
  • глицерин - 50%
Концентрация: диапазон концентрации: 2,17 - 3,49 мг/мл
Метод очистки: очищено с помощью протеина А
Клональность: поликлональные антитела
Изотип: IgG
Области применения: передача сигнала — фосфорилирование белка — серин-треониновые протеинкиназы — другие киназы;
передача сигнала — факторы роста / гормоны — TGF;
передача сигнала — цитоскелет / ECM — внеклеточный матрикс — скелет — костная ткань;
передача сигнала — сигнальный путь — ядерная сигнализация — Smads;
эпигенетика и ядерная сигнализация — пути ядерной сигнализации — Smads;
стволовые клетки — сигнальные пути — TGF-бета — поверхностные молекулы;
стволовые клетки — мезенхимальные стволовые клетки — поверхностные молекулы