Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-IL13 antibody, 100 мкг, Abcam

Антитела поликлональные кроличьи Anti-IL13 antibody, 100 мкг, Abcam


Антитела поликлональные кроличьи Anti-IL13 antibody, 100 мкг
Наименование товара: Anti-IL-13 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к IL-13
Тип хозяина: кролик
Протестированные области применения: WB, IHC-P, IHC-Fr
Кросс-реактивность: мышь, человек;
также может реагировать с: шимпанзе, макакой-резус
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий человеческому IL-13 aa 25-146. BC096139
Последовательность:
LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSIN
LTA
GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDT
KIE VAQFVKDLLLHLKKLFREGRFN
Положительный контроль: WB: лизат селезенки плода человека. Лизат тканей печени мыши;
IHC-P: кишечная ткань человека;
IHC-Fr: ткань толстой кишки мыши
Форма: лиофилизированный: развести 200 мкл дистиллированной воды. Обратите внимание, что если вы получаете этот продукт в жидкой форме, это значить, что он уже был восстановлен, как описано, и дальнейшее восстановление не требуется
Температурный режим (условия хранения): транспортировка при +4°C. После доставки аликвотировать и хранить при -20°C. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,20;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер;
  • БСА - 1%
Концентрация: в зависимости от восстановления
Метод очистки: очищено иммуногенно
Клональность: поликлональные антитела
Изотип: IgG
Области применения: иммунология — врожденный иммунитет — цитокины — интерлейкины;
рак — опухолевая иммунология — цитокины — интерлейкины;
сердечно-сосудистая система — развитие кровеносных сосудов — маркеры эндотелиальных клеток