Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-SMN/Gemin 1, 100 мкг, Abcam

Антитела поликлональные кроличьи Anti-SMN/Gemin 1, 100 мкг, Abcam


Антитела поликлональные кроличьи Anti-SMN/Gemin 1, 100 мкг
Наименование товара: Anti-SMN/Gemin 1 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к SMN/Gemin 1
Тип хозяина: кролик
Протестированные области применения: WB (вестерн-блоттинг), ICC-IF (иммуноцитохимия / иммунофлуоресценция)
Кросс-реактивность: человек;
также может реагировать с: макакой-крабоедом, орангутаном
Иммуноген (антиген): рекомбинантный белок полной длины (His-tag), соответствующий человеческому SMN / Gemin 1 aa 2-294. Эквивалентно E.coli. N-концевой тег.
Последовательность:
AMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVA
SFK
HALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKC
SAI
WSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEV
ANN
IEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPP
PMP
GPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPP
ICP DSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN
Положительный контроль: ICC / IF: клетки HeLa;
WB: клеточный лизат HeLa, HEK-293T и HepG2; рекомбинантный белок SMN / Gemin 1 человека
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,40;
  • натрий-фосфатный буфер;
  • глицерин - 50%;
  • proclin 300 - 0,05%
Метод очистки: очищали с помощью антиген-специфической аффинной хроматографии с последующей очисткой аффинной хроматографией на белке А
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: неврология — неврологический процесс — нейронная передача сигнала;
эпигенетика и ядерная сигнализация — ДНК / РНК — обработка РНК — сплайсинг