Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-Emx1 antibody, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-Emx1 antibody, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-Emx1 antibody, 100 мкл
Наименование товара: Anti-Emx1 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к Emx1
Тип хозяина: кролик
Протестированные области применения: IHC-P (иммуногистохимия c фиксированием в формалине / PFA с фиксированием в парафине)
Кросс-реактивность: мышь, человек
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий человеческому Emx1 aa 76-162.
Последовательность:
RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDP
LHF YPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Положительный контроль: IHC-P: почечная ткань человека; E11 эмбриональные ткани мозга мыши
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,20;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер;
  • глицерин - 40%
Метод очистки: очищено иммуногенно
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: неврология — неврологический процесс — нейрогенез;
стволовые клетки — нейронные стволовые клетки — внутриклеточный