Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-SMN/Gemin 1, 50 мкг, Abcam

Антитела поликлональные кроличьи Anti-SMN/Gemin 1, 50 мкг, Abcam


Антитела поликлональные кроличьи Anti-SMN/Gemin 1, 50 мкг
Наименование товара: Anti-SMN/Gemin 1 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к SMN/Gemin 1
Тип хозяина: кролик
Протестированные области применения: WB (вестерн-блоттинг), IHC-P (иммуногистохимия c фиксированием в формалине / PFA с фиксированием в парафине), ICC-IF (иммуноцитохимия / иммунофлуоресценция)
Кросс-реактивность: человек;
также может реагировать с макакой
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий человеческому SMN / Gemin 1 aa 3-194.
Последовательность:
MSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVAS
FKH
ALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCS
AIW
SEDGCIYPATIASIDKNSQSQSQVGSQVGSQVGNGVGRKSVGRKSVG
RKSVGSKRVSRKSKKKKKVCKVCKKVKVRKVCKVKKVCKKKVVCKVC
KKKKVKVCKVCKKVKBRKC
Положительный контроль: WB: A549 и лизат цельных клеток HeLa;
IHC: ткань яичка человека;
ICC / IF: клетки HepG2
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при +4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре -20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,40;
  • консервант (проклин) - 0,03%;
  • глицерин - 50%;
  • натрий-фосфатный буфер
Концентрация: при фасовке 50 мкг, концентрация 3 мг/мл
Метод очистки: очищено с помощью протеина G
Примечания о методе очистки: чистота > 95%
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: неврология — неврологический процесс — нейронная передача сигнала;
эпигенетика и ядерная сигнализация — ДНК / РНК — обработка РНК — сплайсинг