Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела Anti-CD74 antibody, 100 мкл, Abcam

Антитела Anti-CD74 antibody, 100 мкл, Abcam


Антитела Anti-CD74 antibody, 100 мкл
Наименование товара: Anti-CD74 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к CD74
Тип хозяина: кролик
Протестированные области применения: IHC-P, WB
Кросс-реактивность: мышь, крыса, человек
Иммуноген (антиген): синтетический пептид, соответствующий человеческому CD74 aa 200-230, конъюгирован с гемоцианином (KLH).
Последовательность:
QKPTDAPPKVLTKCQEEVSHIPAVHPGSFRP
Положительный контроль: почечная ткань человека и ткани карциномы толстой кишки человека
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотровать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • консервант (азид натрия) - 0,09%;
  • глицерин - 50%;
  • БСА - 0,01%
Водный буферный раствор
Концентрация: при фасовке 100 мкл, концентрация 1 мг/мл
Метод очистки: очищено с помощью протеина А
Клональность: поликлональные антитела
Изотип: IgG
Области применения: иммунология — адаптивный иммунитет — B клетки — CD