Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-SPAM1, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-SPAM1, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-SPAM1, 100 мкл
Наименование товара: Anti-SPAM1 antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к SPAM1
Тип хозяина: кролик
Протестированные области применения: WB (вестерн-блоттинг)
Кросс-реактивность: человек
Иммуноген (антиген): синтетический пептид, соответствующий SPAM1 aa 173-222 (человек). Идентификационный номер NCBI NP_694859.
Последовательность:
QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYY
LFP
Положительный контроль: 786-0 цельных клеточных лизатов
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (в течение 1-2 недель). После доставки аликвотировать. Хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • консервант (азид натрия) - 0,09%;
  • сахароза - 2%;
  • натрий-фосфатный буфер
Концентрация: при фасовке 100 мкл, концентрация 0,5 мг/мл
Метод очистки: очищено иммуногенно
Клональность: поликлональные антитела
Изотип: IgG
Области исследовния: передача сигнала — цитоскелет / ECM — базальная пластинка;
передача сигнала — цитоскелет / ECM — внеклеточный матрикс — ECM ферменты — другие ферменты;
рак — вторжение / микросреда — ECM — внеклеточный матрикс — другое;
биология развития — репродукция — оплодотворение