Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-c-Fos antibody, 100 мкл, Abcam

Антитела поликлональные кроличьи Anti-c-Fos antibody, 100 мкл, Abcam


Антитела поликлональные кроличьи Anti-c-Fos antibody, 100 мкл
Наименование товара: Anti-c-Fos antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к c-Fos
Тип хозяина: кролик
Протестированные области применения: WB, ICC/IF, IHC-FrFl, IHC-Fr
Кросс-реактивность: мышь, крыса, лошадь, курица, корова, человек, свинья;
также может реагировать с: хомяком, кошкой, китайским хомяком
Иммуноген: рекомбинантный белок полной длины, соответствующий человеческому c-Fos 1-380. Экспрессируется и очищается от кишечной палочки.
Последовательность:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQ
DFC
TDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFG
VPA
PSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERN
KMA
AAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFIL
AAH
RPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDP
EPK
PSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGS
FYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPE
ADS FPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Положительный контроль: ICC / IF: клетки HeLa, стимулированные 20% FBS;
WB: лизат клеток HeLa, стимулированный 20% FBS;
IHC-Fr: ткань мозга мыши;
IHC: ткань мозга мыши
Форма: жидкость
Температурный режим (условия хранения): транспортировка и хранение при + 4°C кратковременно (1-2 недели). После доставки аликвотровать и хранить при температуре - 20°C в течение длительного времени. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • натрий-фосфатный буфер - 100%
Концентрация: при фасовке 100 мкл концентрация 1 мг/мл
Метод очистки: очищено с помощью протеина А
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: неврология — маркер типа клеток — нейронный маркер — Сома-маркеры;
эпигенетика и ядерная сигнализация — транскрипция — Domain Families — HLH / лейциновая "молния" — лейциновая "молния";
эпигенетика и ядерная сигнализация — транскрипция — восприимчивость к раку — протоонкогены;
рак — онкопротеины / супрессоров — онкопротеины — транскрипционные факторы;
рак — опухолевые биомаркеры — онкопротеины