Регион:

Добро пожаловать на сайт группы компаний Альгимед.
Пожалуйста, выберите ваш регион

Заказ 0
  • На данный момент у Вас ни одной заявки. Пожалуйста, перейдите в каталог, чтобы выбрать товар.

Связаться с нами
Более 12565 позиций в каталоге.   Свыше 11 100 довольных клиентов!
Главная/Каталог продукции/Химические реактивы и наборы реагентов/Антитела/Антитела поликлональные кроличьи Anti-LYPD1 / PHTS, 100 мкг, Abcam

Антитела поликлональные кроличьи Anti-LYPD1 / PHTS, 100 мкг, Abcam


Антитела поликлональные кроличьи Anti-LYPD1 / PHTS, 100 мкг
Наименование товара: Anti-LYPD1/PHTS antibody Чтобы заказать антитела, свяжитесь с нашими менеджерами:

Россия:
Беларусь:
Казахстан:
Узбекистан:
Описание: антитела кроличьи поликлональные к LYPD1/PHTS
Тип хозяина: кролик
Протестированные области применения: WB, IHC-P
Кросс-реактивность: реагирует с человеком;
также может реагировать с мышью
Иммуноген (антиген): рекомбинантный фрагмент, соответствующий человеческому LYPD1 / PHTS aa 22-71. (BC017318)
Последовательность: QIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSC
Положительный контроль: лизат почек мыши; фетальная почечная ткань человека
Форма: лиофилизированный: развести в 200 мкл стерильной дистиллированной воды
Температурный режим (условия хранения): транспортировка при + 4°C. После доставки аликвотровать и хранить при температуре - 20°C. Избегать повторной заморозки и оттаивания
Буфер для хранения:
  • pH: 7,20;
  • консервант (азид натрия) - 0,02%;
  • натрий-фосфатный буфер - 98%;
  • БСА - 1%
Концентрация: восстановление
Метод очистки: очищено иммуногенно
Клональность: поликлональные антитела
Изотип: IgG
Области исследования: клеточная биология — клеточный цикл — ингибиторы клеточного цикла — p53;
клеточная биология — апоптоз — внутриклеточный — р53 путь;
эпигенетика и ядерная сигнализация — ДНК / РНК — повреждение ДНК и восстановление — ответ повреждения ДНК — p53;
рак — клеточный цикл — ингибиторы клеточного цикла — путь р53